PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018790-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 272aa    MW: 30828.4 Da    PI: 8.0319
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018790-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++++++G g W +++ + g++R++k+c++rw++yl
    NNU_018790-RA 16 KGAWTKEEDILLRKCIERYGEGKWCLVPLRAGLNRCRKSCRLRWLNYL 63
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3811367IPR017930Myb domain
SuperFamilySSF466895.35E-2113102IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-201466IPR009057Homeodomain-like
SMARTSM007178.5E-141565IPR001005SANT/Myb domain
PfamPF002497.9E-151663IPR001005SANT/Myb domain
CDDcd001674.55E-111863No hitNo description
Gene3DG3DSA:1.10.10.604.6E-1167110IPR009057Homeodomain-like
PROSITE profilePS5129410.2868111IPR017930Myb domain
SMARTSM007172.5E-468109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTRTCEVMDG FLGLRKGAWT KEEDILLRKC IERYGEGKWC LVPLRAGLNR CRKSCRLRWL  60
NYLRSDIKRG KFTLDEVDLI IRLHKLLGNR LPGRTANDIK NYCNTRLSKK KLVSKEEKKA  120
NTTVEKIKAI RPQPRTFTKS SRWFRPLXDP TSEGATSQSG EILSKAXPDN STTVGTNNRS  180
GEMPNETSPD LPPPTNDLVQ WWKSVLDESD MVDTTCPIIS GSEEDSLAVE VQPAMTGFGN  240
IYEEIXSTTD EGDHLSFSKN IWDLLASDMD II
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-17101101107B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274762.10.0PREDICTED: transcription factor MYB90-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.19e-50myb domain protein 113